Cel-sci Corporation

Viral Technologies, Inc.

Cell Med, Inc.

Molecular Rx, Inc.

Molecullar Rx, Inc.

Talor, Eyal

Steiner, Harold

Glant, Tibor

Zimmerman, Daniel, H.

Mikecz, Katalin

Carambula, Roy

Daniel H Zimmerman

Prem S Sarin

Ellis L Kline

Eyal Talor

Donald A Elliott

Kenneth Rosenthal

Kanta Subbarao

Katalin Mikecz

Kobporn Boonnak

Harold Steiner

Roy Carambula

Tibor Glant

The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of autoimmune diseases, specifically rheumatoid arthritis (RA) and compositions containing same, methods for producing same and methods for using same; wherein the peptide constructs have the formula P-x-Pwhere Pis a peptide associated with autoimmune disease, allergy, asthma, host-versus-graft rejection, myocarditis, diabetes, and immune-mediated disease, which binds to an antigen receptor on a set or subset of T cells; Pis a peptide which will cause a T2 directed immune response by the set or subset of T cells to which the peptide Pis attached or which will bind to a T cell receptor which will cause the set or subset of T cells to which the peptide Pis attached to initiate, but not complete, an immune response causing the set or subset of T cells to undergo anergy and apoptosis; and x is a direct bond or linker for covalently bonding Pand P.

Methods of preparation and composition of peptide constructs useful for treatment of rheumatoid arthritis

A vaccine for immunization against Type A influenza virus is provided having an immunologically effective amount of peptide constructs obtained by linking together two or more peptides based on or derived from different molecules, and methods for producing the same. The peptide constructs have the formula P-x-Por P-x-Pwhere Pis associated with Type A influenza highly conserved protein such as but not limited to M2e matrix protein, NP1 nucleoprotein, HA2 core 1, and HA2 core 2, where Pis a peptide construct causing a T1 directed immune response by a set or subset of T cells to which the peptide Pis attached or that binds to a dendritic cell or T cell receptor causing said set or subset of dendritic cell or T cells to which the peptide Pis attached to initiate and complete, an immune response, and x is a direct bond or divalent linker for covalently bonding Pand P.

Method for inducing an immune response against avian, swine, spanish, H1N1, H5N9 influenza viruses and formulations thereof

The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of influenza virus and other infectious diseases. Compositions containing the same, methods for producing the same, and methods for using the same are also disclosed, wherein the peptide constructs have the formula P-x-P, where Pis a peptide associated with an infectious agent and Pis a peptide that will bind to a class of immune cells, such as dendritic cells. The peptide construct can cause the maturation of immature dendritic cells to a more mature state. The peptide construct or the more mature dendritic cell can be administered to a subject to modulate or initiate an immune response against an infectious agent. Dyes, radioisotopes, or therapeutic agents conjugated with the dendritic cells can be used for localization of the immune target and/or prophylactic or therapeutic treatment of the disease.

Method for inducing an immune response and formulations thereof

The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of cancer or the treatment of autoimmune diseases and compositions containing same, methods for producing same, and methods for using same; wherein the peptide constructs have the formula P-x-Pwhere Pis a peptide associated with forms of cancer or an autoimmune condition and Pis a peptide which will bind to a class of immune cells such as dendritic cells. The peptide construct can cause the maturation of immature dendritic cells to a more mature state. The peptide construct or the more mature dendritic cells can be administered to a subject to a modulate or to initiate an immune response against cancer cells, and can be used with dyes, radioisotopes, or therapeutic agents for detection of the immune target and/or treatment of cancer and autoimmune conditions.

Method for inducing an immune response for treatment of cancer and autoimmune diseases or conditions

Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

Methods of preparation and composition of peptide constructs useful for treatment of autoimmune and transplant related host versus graft conditions

Preparation and composition of peptides useful for treatment of autoimmune and transplant related graft versus host conditions

The present invention is based, in part, on the discovery that a modified version of Peptide G (Asn Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile&#x2014;SEQ ID NO:2) obtained by replacing Asn with Asp to form Peptide G' (Asp Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile&#x2014;SEQ ID NO: 1) overcomes the long range stabilization problem of the peptide conjugates and, quite surprisingly, also enhances the immune response, particularly the CD4 related (cell mediated) response, of conjugated peptides (L.E.A.P.S. constructs) as previously described.

T cell binding ligand peptides and method of inducing a cellular immune response

Peptide constructs chemically synthesized to contain a Herpes Simplex Virus specific antigenic peptide, such as, the 322-332 peptide (H1) from the ICP27 protein of Herpes Simplex Virus (HSV-1) and a peptide from a T cell binding ligand (TCBL), such as &bgr;-2M (aa 35-50), which elicits a TH1-like response in vitro tests in mice, were protective against challenge with HSV.

Immunogenic conjugated polypeptide for treatment of herpes simplex virus

Modified HGP-30 heteroconjugates, compositions and methods of use

An antigenic peptide fragment from the p17 gag protein of HIV includes a portion from HGP-30 and a contiguous portion from HGP-35 such that the peptide fragment is capable of inducing a TH1 immune response when administered to a person suffering from AIDS or at risk for AIDS. The peptide has from about 25 to about 37 amino acids, such as, for example, the sequence

Modified HGP-30 peptides, conjugates, compositions and methods of use

HIV-1P-17 peptide fragments, compositions containing and methods for producing and using same

Peptide fragments of the p17 gag protein of HIV-1 from Clade C of from about 30 to about 50 amino acids, including the region extending from position 75 to position 129, raise antibodies recognizing other subtypes, including Clade A, Clade B, Clade E as well as peptides of non-coextensive but overlapping portions of the p17 gag protein. DNA sequences can be used to encode for the peptides of interest. An example of the Clade C peptide of this invention is a peptide having about 30 to about 32 amino acids taken consecutively from a part or the entirety of the following sequence:

HIV-1 p-17 peptide fragments, compositions containing and methods for

A heteroconjugate is formed by linking a T cell binding ligand (TCBL) such as Peptide J of .beta.-2 microglobulin to a modified HGP-30 antigentic peptide fragment of p17 gag peptide, such as. for example

The present invention relates to a heterofunctional cellular immunological reagent comprising at least two T cell specific binding ligands covalently linked together, wherein one of the T cell specific binding ligands binds to a specific class or subclass of T cells and another of the T cell specific binding ligands is an antigen associated with disease or a causative agent of disease, or epitope thereof. The present invention also relates to vaccines containing the heterofunctional cellular immunological reagents and methods for the use of the same.

Heterofunctional cellular immunological reagents, vaccines containing

An antigenic peptide fragment from the p17 gag protein of HIV includes a portion from HGP-30 and a contiguous portion from HGP-35 such that the peptide fragment is capable of inducing a TH1 immune response when administered to a person suffering from AIDS or at risk for AIDS. The peptide has from about 25 to about 37 amino acids, such as, for example, the sequence ##EQU1##

Growing community of inventors

Bethesda, MD, United States of America

Daniel H Zimmerman