Affiris Ag

Affiris Cvd Gmbh

Claudia Juno

Sylvia Brunner

Guenther Staffler

Gergana Galabova

Gabriele Winsauer

Erika Bilcikova

Pola Linzmayer-Hirt

Birgit Schuh

Bettina Wanko

Markus Windwarder

Gunther Staffler

Andreas Mairhofer

Mathias Gebhart

Günther Staffler

The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.

Peptide vaccines for hypercholesterolemia related diseases

Peptide vaccines usable for hypercholesterolemia related diseases

The present invention relates to a vaccine capable to induce production of antibodies directed to PCSK9 in vivo.

Peptide vaccines against PCSK9

Treatments using a peptide and/or vaccine

The present invention relates to a immunogen comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID NO:9).

PCSK9 peptide combination vaccine and method of use

Vaccine capable of inducing formation of antibodies directed to proprotein convertase subtilisin/kexin type 9 (PCSK9) in vivo

A vaccine or immunogenic composition comprising at least two fragments of proprotein convertase subtilisin/kexin type 9 (PCSK9) where one fragment contains at least 9 consecutive residues of residues 153 to 165 of PCSK9 and the other fragment contains at least 9 consecutive residues 209 to 222 of the PCSK9 (SEQ ID NO:9). Methods of treatment for hyperlipidemia, hypercholesterolemia, and atherosclerosis involving administering this vaccine.

The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.

CETP fragments

Growing community of inventors

Vienna, Austria

Claudia Juno