Duke University

Yeda Research and Develpment & Co. Ltd

Charles S Greenberg

Mark W Dewhirst

Michal Neeman

Zishan A Haroon

Imaging agents for magnetic resonance imaging are disclosed. Methods of monitoring angiogenesis and the growth and remission of tumor tissue are also disclosed. Methods of monitoring blood clot formation and dissolution are additionally disclosed. Methods of monitoring wound healing are further disclosed. A kit for obtaining an image of a biological structure is further disclosed.

Contrast enhancement agent for magnetic resonance imaging

Fibrin binding peptides disclosed include (a) peptides having the amino acid sequence of a human Blood Coagulation Factor XIIIA fragment (i.e., NKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDR SVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFY GEVNDIKTRSWSYGQF-R', where R, is --CONH.sub.2 or --NH.sub.2); (b) peptides which are fragments of the foregoing Factor XIIIA fragment and which retain the capability thereof of binding to fibrin; and (c) peptides which bind to fibrin, which have the amino acid sequence of any of the foregoing peptides, and which have additional amino acid residues attached to the N-terminal end and/or the C-terminal end thereof. The peptides are useful for localizing blood clots in vivo, inhibiting fibrin stabilization, and promoting thrombolysis.

Growing community of inventors

Raleigh, NC, United States of America

Charles S Greenberg